Lineage for d1mcol2 (1mco L:112-216)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293989Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1293993Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1294072Domain d1mcol2: 1mco L:112-216 [21468]
    Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh3, d1mcoh4, d1mcol1
    part of intact antibody MCG

Details for d1mcol2

PDB Entry: 1mco (more details), 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion
PDB Compounds: (L:) igg1 mcg intact antibody (light chain)

SCOPe Domain Sequences for d1mcol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcol2 b.1.1.2 (L:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatevclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d1mcol2:

Click to download the PDB-style file with coordinates for d1mcol2.
(The format of our PDB-style files is described here.)

Timeline for d1mcol2: