![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries) |
![]() | Domain d1mcol2: 1mco L:112-216 [21468] Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh3, d1mcoh4, d1mcol1 part of intact antibody MCG complexed with bma, ful, gal, gup, man, nag, sia |
PDB Entry: 1mco (more details), 3.2 Å
SCOPe Domain Sequences for d1mcol2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcol2 b.1.1.2 (L:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseelqankatevclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1mcol2:
![]() Domains from other chains: (mouse over for more information) d1mcoh1, d1mcoh2, d1mcoh3, d1mcoh4 |