Lineage for d1lilb2 (1lil B:108-215)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290004Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 290008Species Human (Homo sapiens) [TaxId:9606] [88572] (33 PDB entries)
  8. 290049Domain d1lilb2: 1lil B:108-215 [21467]
    Other proteins in same PDB: d1lila1, d1lilb1
    part of Bence-Jones protein CLE

Details for d1lilb2

PDB Entry: 1lil (more details), 2.65 Å

PDB Description: bence jones protein cle, a lambda iii immunoglobulin light-chain dimer

SCOP Domain Sequences for d1lilb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lilb2 b.1.1.2 (B:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d1lilb2:

Click to download the PDB-style file with coordinates for d1lilb2.
(The format of our PDB-style files is described here.)

Timeline for d1lilb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lilb1