SCOPe 2.03: Domain d3p54a1: 3p54 A:1-299

Lineage for d3p54a1 (3p54 A:1-299)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.0: automated matches [227258] (1 protein)
   not a true family

6. Protein automated matches [227047] (3 species)
   not a true protein

7. Species Japanese encephalitis virus [TaxId:11072] [226036] (1 PDB entry)

8. Domain d3p54a1: 3p54 A:1-299 [214662]
   Other proteins in same PDB: d3p54a2
   automated match to d1urza2

Details for d3p54a1

PDB Entry: 3p54, 2.1 Å

PDB Description: Crystal Structure of the Japanese Encephalitis Virus Envelope Protein, strain SA-14-14-2.

PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d3p54a1:

Sequence; same for both SEQRES and ATOM records:

>d3p54a1 f.10.1.0 (A:1-299) automated matches {Japanese encephalitis virus [TaxId: 11072]}
fnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminieasqlaevrsyc
yhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcgffgkgsidtcakfs
ctskaigrtiqpenikykvgifvhgtttsenhgnysaqvgasqaakftvtpnapsvtlkl
gdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspsstawrnrellm
efegahatkqsvvalgsqegglhqalagaivveysssvmltsghlkcrlkmdklalkgt

Timeline for d3p54a1:

• d3p54a1 is new in SCOPe 2.03-stable
  
• d3p54a1 appears in SCOPe 2.04
  
• d3p54a1 appears in the current release, SCOPe 2.08