![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) |
![]() | Domain d1lila2: 1lil A:108-215 [21466] Other proteins in same PDB: d1lila1, d1lilb1 part of Bence-Jones protein CLE |
PDB Entry: 1lil (more details), 2.65 Å
SCOPe Domain Sequences for d1lila2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lila2 b.1.1.2 (A:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1lila2: