SCOP 1.65: Domain d4bjlb2: 4bjl B:112-216

Lineage for d4bjlb2 (4bjl B:112-216)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (33 PDB entries)

8. Domain d4bjlb2: 4bjl B:112-216 [21465]
   Other proteins in same PDB: d4bjla1, d4bjlb1
   part of Bence-Jones protein LOC

Details for d4bjlb2

PDB Entry: 4bjl, 2.4 Å

PDB Description: locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water

SCOP Domain Sequences for d4bjlb2:

Sequence; same for both SEQRES and ATOM records:

>d4bjlb2 b.1.1.2 (B:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d4bjlb2:

• d4bjlb2 first appeared (with stable ids) in SCOP 1.55
  
• d4bjlb2 appears in SCOP 1.63
  
• d4bjlb2 appears in SCOP 1.67
  
• d4bjlb2 appears in the current release, SCOPe 2.08