Lineage for d4bjla2 (4bjl A:112-216)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2360928Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)
  8. 2360959Domain d4bjla2: 4bjl A:112-216 [21464]
    Other proteins in same PDB: d4bjla1, d4bjlb1
    part of Bence-Jones protein LOC

Details for d4bjla2

PDB Entry: 4bjl (more details), 2.4 Å

PDB Description: locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water
PDB Compounds: (A:) loc - lambda 1 type light-chain dimer

SCOPe Domain Sequences for d4bjla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bjla2 b.1.1.2 (A:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d4bjla2:

Click to download the PDB-style file with coordinates for d4bjla2.
(The format of our PDB-style files is described here.)

Timeline for d4bjla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bjla1