Lineage for d3p1td_ (3p1t D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614432Species Burkholderia pseudomallei [TaxId:28450] [225995] (3 PDB entries)
  8. 1614441Domain d3p1td_: 3p1t D: [214627]
    automated match to d1uu0c_
    complexed with edo, so4, tla

Details for d3p1td_

PDB Entry: 3p1t (more details), 2.6 Å

PDB Description: crystal structure of a putative aminotransferase (bpsl1724) from burkholderia pseudomallei k96243 at 2.60 a resolution
PDB Compounds: (D:) Putative histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3p1td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1td_ c.67.1.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
avclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrklaehfscpednlmlvrgi
decfdrisaefssmrfvtawpgfdgyrariavsglrhfeigltddllldpndlaqvsrdd
cvvlanpsnptgqalsageldqlrqragkllidetyvdyssfrarglaygenelvfrsfs
ksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaaldndrareahiaktlaq
rrrvadalrglgyrvasseanfvlvenaagertlrflrergiqvkdagqfglhhhirisi
greedndrllaalaeys

SCOPe Domain Coordinates for d3p1td_:

Click to download the PDB-style file with coordinates for d3p1td_.
(The format of our PDB-style files is described here.)

Timeline for d3p1td_: