Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (83 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [225995] (3 PDB entries) |
Domain d3p1td_: 3p1t D: [214627] automated match to d1uu0c_ complexed with edo, so4, tla |
PDB Entry: 3p1t (more details), 2.6 Å
SCOPe Domain Sequences for d3p1td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p1td_ c.67.1.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 28450]} avclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrklaehfscpednlmlvrgi decfdrisaefssmrfvtawpgfdgyrariavsglrhfeigltddllldpndlaqvsrdd cvvlanpsnptgqalsageldqlrqragkllidetyvdyssfrarglaygenelvfrsfs ksyglaglrlgalfgpseliaamkrkqwfcnvgtldlhaleaaldndrareahiaktlaq rrrvadalrglgyrvasseanfvlvenaagertlrflrergiqvkdagqfglhhhirisi greedndrllaalaeys
Timeline for d3p1td_: