Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (26 species) not a true protein |
Species Xenotropic mulv-related virus [TaxId:438045] [225994] (1 PDB entry) |
Domain d3p1ga_: 3p1g A: [214620] automated match to d4e89a_ complexed with mg |
PDB Entry: 3p1g (more details), 1.5 Å
SCOPe Domain Sequences for d3p1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p1ga_ c.55.3.0 (A:) automated matches {Xenotropic mulv-related virus [TaxId: 438045]} aethgtrpdltdqpipdadytwytdgssflqegqrragaavtteteviwaralpagtsaq raelialtqalkmaegkklnvytdsryafatahvhsegreiknkneilallkalflpkrl siihcpghqkgnsaeargnrmadqaareaamkavlet
Timeline for d3p1ga_: