Lineage for d3p1ga_ (3p1g A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1607696Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1607697Protein automated matches [190396] (26 species)
    not a true protein
  7. 1607889Species Xenotropic mulv-related virus [TaxId:438045] [225994] (1 PDB entry)
  8. 1607890Domain d3p1ga_: 3p1g A: [214620]
    automated match to d4e89a_
    complexed with mg

Details for d3p1ga_

PDB Entry: 3p1g (more details), 1.5 Å

PDB Description: Crystal Structure of the Xenotropic Murine Leukemia Virus-Related Virus (XMRV) RNase H Domain
PDB Compounds: (A:) Xenotropic Murine Leukemia Virus-Related Virus (XMRV) RNase H Domain

SCOPe Domain Sequences for d3p1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1ga_ c.55.3.0 (A:) automated matches {Xenotropic mulv-related virus [TaxId: 438045]}
aethgtrpdltdqpipdadytwytdgssflqegqrragaavtteteviwaralpagtsaq
raelialtqalkmaegkklnvytdsryafatahvhsegreiknkneilallkalflpkrl
siihcpghqkgnsaeargnrmadqaareaamkavlet

SCOPe Domain Coordinates for d3p1ga_:

Click to download the PDB-style file with coordinates for d3p1ga_.
(The format of our PDB-style files is described here.)

Timeline for d3p1ga_: