SCOPe 2.07: Domain d3p0yl1: 3p0y L:1-107

Lineage for d3p0yl1 (3p0y L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3p0yl1: 3p0y L:1-107 [214618]
   Other proteins in same PDB: d3p0ya1, d3p0ya2, d3p0yl2
   automated match to d1rhha1
   complexed with gol

Details for d3p0yl1

PDB Entry: 3p0y, 1.8 Å

PDB Description: anti-egfr/her3 fab dl11 in complex with domain iii of egfr extracellular region

PDB Compounds: (L:) Fab DL11 light chain

SCOPe Domain Sequences for d3p0yl1:

Sequence; same for both SEQRES and ATOM records:

>d3p0yl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdlatdvawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsepepytfgqgtkveik

Timeline for d3p0yl1:

• d3p0yl1 first appeared in SCOPe 2.03
  
• d3p0yl1 appears in SCOPe 2.06
  
• d3p0yl1 appears in the current release, SCOPe 2.08