Lineage for d1bjmb2 (1bjm B:112-216)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53392Species Bence-Jones lambda L chain dimer LOC (human) [49114] (3 PDB entries)
  8. 53394Domain d1bjmb2: 1bjm B:112-216 [21461]
    Other proteins in same PDB: d1bjma1, d1bjmb1

Details for d1bjmb2

PDB Entry: 1bjm (more details), 2.2 Å

PDB Description: loc naks, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in nakso4

SCOP Domain Sequences for d1bjmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjmb2 b.1.1.2 (B:112-216) Immunoglobulin (constant domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d1bjmb2:

Click to download the PDB-style file with coordinates for d1bjmb2.
(The format of our PDB-style files is described here.)

Timeline for d1bjmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bjmb1