Lineage for d1egjh2 (1egj H:114-225)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289415Domain d1egjh2: 1egj H:114-225 [21457]
    Other proteins in same PDB: d1egja_, d1egjh1, d1egjl1, d1egjl2
    part of Fab 13B5 against cytokine receptor common beta chain domain 4
    complexed with nag

Details for d1egjh2

PDB Entry: 1egj (more details), 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

SCOP Domain Sequences for d1egjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egjh2 b.1.1.2 (H:114-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkivpqv

SCOP Domain Coordinates for d1egjh2:

Click to download the PDB-style file with coordinates for d1egjh2.
(The format of our PDB-style files is described here.)

Timeline for d1egjh2: