Lineage for d1egjh2 (1egj H:114-225)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221354Species Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain [49112] (1 PDB entry)
  8. 221355Domain d1egjh2: 1egj H:114-225 [21457]
    Other proteins in same PDB: d1egja_, d1egjh1, d1egjl1
    complexed with nag

Details for d1egjh2

PDB Entry: 1egj (more details), 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

SCOP Domain Sequences for d1egjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egjh2 b.1.1.2 (H:114-225) Immunoglobulin (constant domains of L and H chains) {Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkivpqv

SCOP Domain Coordinates for d1egjh2:

Click to download the PDB-style file with coordinates for d1egjh2.
(The format of our PDB-style files is described here.)

Timeline for d1egjh2: