SCOP 1.61: Domain d1egjh2: 1egj H:114-225

Lineage for d1egjh2 (1egj H:114-225)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain [49112] (1 PDB entry)

8. Domain d1egjh2: 1egj H:114-225 [21457]
   Other proteins in same PDB: d1egja_, d1egjh1, d1egjl1

Details for d1egjh2

PDB Entry: 1egj, 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

SCOP Domain Sequences for d1egjh2:

Sequence; same for both SEQRES and ATOM records:

>d1egjh2 b.1.1.2 (H:114-225) Immunoglobulin (constant domains of L and H chains) {Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkivpqv

Timeline for d1egjh2:

• d1egjh2 first appeared (with stable ids) in SCOP 1.55
  
• d1egjh2 appears in SCOP 1.59
  
• d1egjh2 appears in SCOP 1.63
  
• d1egjh2 appears in the current release, SCOPe 2.08