Lineage for d1egjh2 (1egj H:114-225)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8810Species Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain [49112] (1 PDB entry)
  8. 8811Domain d1egjh2: 1egj H:114-225 [21457]
    Other proteins in same PDB: d1egja_, d1egjh1, d1egjl1

Details for d1egjh2

PDB Entry: 1egj (more details), 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

SCOP Domain Sequences for d1egjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egjh2 b.1.1.2 (H:114-225) Immunoglobulin (constant domains of L and H chains) {Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkivpqv

SCOP Domain Coordinates for d1egjh2:

Click to download the PDB-style file with coordinates for d1egjh2.
(The format of our PDB-style files is described here.)

Timeline for d1egjh2: