SCOPe 2.05: Domain d3ov2d2: 3ov2 D:236-391

Lineage for d3ov2d2 (3ov2 D:236-391)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (52 species)
   not a true protein

7. Species Curcuma longa [TaxId:136217] [226034] (2 PDB entries)

8. Domain d3ov2d2: 3ov2 D:236-391 [214563]
   automated match to d1bi5a2
   complexed with edo, mli

Details for d3ov2d2

PDB Entry: 3ov2, 2.32 Å

PDB Description: Curcumin synthase 1 from Curcuma longa

PDB Compounds: (D:) Curcumin synthase

SCOPe Domain Sequences for d3ov2d2:

Sequence; same for both SEQRES and ATOM records:

>d3ov2d2 c.95.1.0 (D:236-391) automated matches {Curcuma longa [TaxId: 136217]}
iyeiaaamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrew
ndvfwvahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsav
egrsttgdglqwgvllgfgpglsietvvlrsmplhh

Timeline for d3ov2d2:

• d3ov2d2 first appeared in SCOPe 2.03
  
• d3ov2d2 appears in SCOPe 2.04
  
• d3ov2d2 appears in SCOPe 2.06
  
• d3ov2d2 appears in the current release, SCOPe 2.08