Lineage for d3ov2c1 (3ov2 C:2-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917589Species Curcuma longa [TaxId:136217] [226034] (2 PDB entries)
  8. 2917594Domain d3ov2c1: 3ov2 C:2-235 [214560]
    Other proteins in same PDB: d3ov2a3, d3ov2b3, d3ov2c3, d3ov2d3
    automated match to d1cmla1
    complexed with edo, mli

Details for d3ov2c1

PDB Entry: 3ov2 (more details), 2.32 Å

PDB Description: Curcumin synthase 1 from Curcuma longa
PDB Compounds: (C:) Curcumin synthase

SCOPe Domain Sequences for d3ov2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ov2c1 c.95.1.0 (C:2-235) automated matches {Curcuma longa [TaxId: 136217]}
anlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmce
ktmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpk
seithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaenn
rgarvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekp

SCOPe Domain Coordinates for d3ov2c1:

Click to download the PDB-style file with coordinates for d3ov2c1.
(The format of our PDB-style files is described here.)

Timeline for d3ov2c1: