Lineage for d3ov2a1 (3ov2 A:3-235)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1392924Species Curcuma longa [TaxId:136217] [226034] (2 PDB entries)
  8. 1392925Domain d3ov2a1: 3ov2 A:3-235 [214556]
    automated match to d1cmla1
    complexed with edo, mli

Details for d3ov2a1

PDB Entry: 3ov2 (more details), 2.32 Å

PDB Description: Curcumin synthase 1 from Curcuma longa
PDB Compounds: (A:) Curcumin synthase

SCOPe Domain Sequences for d3ov2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ov2a1 c.95.1.0 (A:3-235) automated matches {Curcuma longa [TaxId: 136217]}
nlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmcek
tmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpks
eithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaennr
garvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekp

SCOPe Domain Coordinates for d3ov2a1:

Click to download the PDB-style file with coordinates for d3ov2a1.
(The format of our PDB-style files is described here.)

Timeline for d3ov2a1: