Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Toxoplasma gondii [TaxId:508771] [225975] (1 PDB entry) |
Domain d3otra2: 3otr A:148-444 [214542] Other proteins in same PDB: d3otra1, d3otrb1, d3otrc1, d3otrd1, d3otre1, d3otrf1 automated match to d1pdza1 complexed with cl, so4 |
PDB Entry: 3otr (more details), 2.75 Å
SCOPe Domain Sequences for d3otra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3otra2 c.1.11.0 (A:148-444) automated matches {Toxoplasma gondii [TaxId: 508771]} dkmvmpvpffnvinggehagnglalqefliapvgapnireairygsetyhhlknviknky gldatnvgdeggfapnvataeealnllveaikaagyegkikiafdaaasefykqdekkyd ldykcktknaskhltgeklkevyegwlkkypiisvedpfdqddfasfsaftkdvgektqv igddilvtnilriekalkdkacnclllkvnqigsvteaieacllaqksgwgvqvshrsge tedsfiadlvvglrcgqiksgspcrserlckynqlmrieeslgadcvyagesfrhpk
Timeline for d3otra2: