SCOP 1.57: Domain d1e6jl2: 1e6j L:106-210

Lineage for d1e6jl2 (1e6j L:106-210)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain [49111] (2 PDB entries)

8. Domain d1e6jl2: 1e6j L:106-210 [21454]
   Other proteins in same PDB: d1e6jh1, d1e6jl1, d1e6jp1, d1e6jp2

Details for d1e6jl2

PDB Entry: 1e6j, 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5

SCOP Domain Sequences for d1e6jl2:

Sequence; same for both SEQRES and ATOM records:

>d1e6jl2 b.1.1.2 (L:106-210) Immunoglobulin (constant domains of L and H chains) {Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1e6jl2:

• d1e6jl2 first appeared (with stable ids) in SCOP 1.55
  
• d1e6jl2 appears in SCOP 1.59
  
• d1e6jl2 appears in the current release, SCOPe 2.08