Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
Species Escherichia coli [TaxId:562] [54722] (12 PDB entries) |
Domain d3ot7b2: 3ot7 B:91-205 [214536] Other proteins in same PDB: d3ot7a1, d3ot7b1, d3ot7c1, d3ot7d1 automated match to d1d5na2 |
PDB Entry: 3ot7 (more details), 1.9 Å
SCOPe Domain Sequences for d3ot7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ot7b2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk
Timeline for d3ot7b2: