SCOPe 2.03: Domain d3ot7b2: 3ot7 B:91-205

Lineage for d3ot7b2 (3ot7 B:91-205)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)

8. Domain d3ot7b2: 3ot7 B:91-205 [214536]
   Other proteins in same PDB: d3ot7a1, d3ot7b1, d3ot7c1, d3ot7d1
   automated match to d1d5na2

Details for d3ot7b2

PDB Entry: 3ot7, 1.9 Å

PDB Description: Escherichia coli apo-manganese superoxide dismutase

PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3ot7b2:

Sequence; same for both SEQRES and ATOM records:

>d3ot7b2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

Timeline for d3ot7b2:

• d3ot7b2 is new in SCOPe 2.03-stable
  
• d3ot7b2 appears in SCOPe 2.04
  
• d3ot7b2 appears in the current release, SCOPe 2.08