Lineage for d1fl3l2 (1fl3 L:114-215)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221119Species Blue fluorescent Fab 19G2, (mouse), kappa L chain [49110] (1 PDB entry)
  8. 221123Domain d1fl3l2: 1fl3 L:114-215 [21449]
    Other proteins in same PDB: d1fl3a1, d1fl3b1, d1fl3h1, d1fl3l1

Details for d1fl3l2

PDB Entry: 1fl3 (more details), 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl3l2 b.1.1.2 (L:114-215) Immunoglobulin (constant domains of L and H chains) {Blue fluorescent Fab 19G2, (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhngytceathktstspivksfn

SCOP Domain Coordinates for d1fl3l2:

Click to download the PDB-style file with coordinates for d1fl3l2.
(The format of our PDB-style files is described here.)

Timeline for d1fl3l2: