Lineage for d3orib_ (3ori B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435613Protein automated matches [190091] (11 species)
    not a true protein
  7. 1436333Species Mycobacterium tuberculosis [TaxId:419947] [226040] (7 PDB entries)
  8. 1436338Domain d3orib_: 3ori B: [214487]
    automated match to d1mrub_
    complexed with ags, mn; mutant

Details for d3orib_

PDB Entry: 3ori (more details), 2 Å

PDB Description: mycobacterium tuberculosis pknb kinase domain l33d mutant (crystal form 1)
PDB Compounds: (B:) Serine/threonine protein kinase

SCOPe Domain Sequences for d3orib_:

Sequence, based on SEQRES records: (download)

>d3orib_ d.144.1.7 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfrreaqnaaalnhp
aivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviadacqalnfs
hqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqylspeqar
gdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadlda
vvlkalaknpenryqtaaemradlvrvhngeppeapkvltd

Sequence, based on observed residues (ATOM records): (download)

>d3orib_ d.144.1.7 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfrreaqnaaalnhp
aivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviadacqalnfs
hqngiihrdvkpanimisatnavkvmdfgiaraigtaqylspeqargdsvdarsdvyslg
cvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknpenry
qtaaemradlvrvhngeppeapkvltd

SCOPe Domain Coordinates for d3orib_:

Click to download the PDB-style file with coordinates for d3orib_.
(The format of our PDB-style files is described here.)

Timeline for d3orib_: