Lineage for d1emth2 (1emt H:117-216)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365270Domain d1emth2: 1emt H:117-216 [21447]
    Other proteins in same PDB: d1emth1, d1emtl1, d1emtl2
    part of anti-C60 fullerene Fab

Details for d1emth2

PDB Entry: 1emt (more details), 2.25 Å

PDB Description: fab antibody fragment of an c60 antifullerene antibody

SCOP Domain Sequences for d1emth2:

Sequence, based on SEQRES records: (download)

>d1emth2 b.1.1.2 (H:117-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1emth2 b.1.1.2 (H:117-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpssprpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1emth2:

Click to download the PDB-style file with coordinates for d1emth2.
(The format of our PDB-style files is described here.)

Timeline for d1emth2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emth1