Lineage for d1emth2 (1emt H:117-216)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53270Species Anti-C60 fullerene Fab, (mouse), kappa L chain [49109] (1 PDB entry)
  8. 53271Domain d1emth2: 1emt H:117-216 [21447]
    Other proteins in same PDB: d1emth1, d1emtl1

Details for d1emth2

PDB Entry: 1emt (more details), 2.25 Å

PDB Description: fab antibody fragment of an c60 antifullerene antibody

SCOP Domain Sequences for d1emth2:

Sequence, based on SEQRES records: (download)

>d1emth2 b.1.1.2 (H:117-216) Immunoglobulin (constant domains of L and H chains) {Anti-C60 fullerene Fab, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1emth2 b.1.1.2 (H:117-216) Immunoglobulin (constant domains of L and H chains) {Anti-C60 fullerene Fab, (mouse), kappa L chain}
akttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpssprpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1emth2:

Click to download the PDB-style file with coordinates for d1emth2.
(The format of our PDB-style files is described here.)

Timeline for d1emth2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emth1