Lineage for d3opla_ (3opl A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949540Protein beta-Lactamase, class A [56606] (16 species)
  7. 1949659Species Klebsiella pneumoniae [TaxId:573] [225597] (9 PDB entries)
  8. 1949667Domain d3opla_: 3opl A: [214463]
    automated match to d1jtda_
    complexed with epe, ma4; mutant

Details for d3opla_

PDB Entry: 3opl (more details), 1.8 Å

PDB Description: ESBL R164H mutant SHV-1 beta-lactamase
PDB Compounds: (A:) Beta-lactamase SHV-1

SCOPe Domain Sequences for d3opla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3opla_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldhwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

SCOPe Domain Coordinates for d3opla_:

Click to download the PDB-style file with coordinates for d3opla_.
(The format of our PDB-style files is described here.)

Timeline for d3opla_: