SCOPe 2.06: Domain d3opha_: 3oph A:

Lineage for d3opha_ (3oph A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Klebsiella pneumoniae [TaxId:573] [225597] (9 PDB entries)

8. Domain d3opha_: 3oph A: [214462]
   automated match to d1jtda_
   complexed with epe, ma4; mutant

Details for d3opha_

PDB Entry: 3oph, 1.34 Å

PDB Description: ESBL R164S mutant of SHV-1 beta-lactamase

PDB Compounds: (A:) Beta-lactamase SHV-1

SCOPe Domain Sequences for d3opha_:

Sequence; same for both SEQRES and ATOM records:

>d3opha_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldswetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

Timeline for d3opha_:

• d3opha_ first appeared in SCOPe 2.03
  
• d3opha_ appears in SCOPe 2.05
  
• d3opha_ appears in SCOPe 2.07
  
• d3opha_ appears in the current release, SCOPe 2.08