SCOPe 2.08: Domain d3opdc_: 3opd C:

Lineage for d3opdc_ (3opd C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:5702] [224939] (1 PDB entry)

8. Domain d3opdc_: 3opd C: [214461]
   Other proteins in same PDB: d3opda2, d3opdb2
   automated match to d3omub_
   complexed with hie

Details for d3opdc_

PDB Entry: 3opd, 2.6 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a benzamide derivative

PDB Compounds: (C:) Heat shock protein 83

SCOPe Domain Sequences for d3opdc_:

Sequence, based on SEQRES records:

>d3opdc_ d.122.1.1 (C:) automated matches {Trypanosoma brucei [TaxId: 5702]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedqq
eyleerrlkdlikkhsefigydielmven

Sequence, based on observed residues (ATOM records):

>d3opdc_ d.122.1.1 (C:) automated matches {Trypanosoma brucei [TaxId: 5702]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvphlrir
vipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfgvgfy
saylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedqqeyle
errlkdlikkhsgydielmven

Timeline for d3opdc_:

• d3opdc_ first appeared in SCOPe 2.03
  
• d3opdc_ appears in SCOPe 2.07