Lineage for d3opda1 (3opd A:1-209)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973756Species Trypanosoma brucei [TaxId:5702] [224939] (1 PDB entry)
  8. 2973757Domain d3opda1: 3opd A:1-209 [214459]
    Other proteins in same PDB: d3opda2, d3opdb2
    automated match to d3omub_
    complexed with hie

Details for d3opda1

PDB Entry: 3opd (more details), 2.6 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a benzamide derivative
PDB Compounds: (A:) Heat shock protein 83

SCOPe Domain Sequences for d3opda1:

Sequence, based on SEQRES records: (download)

>d3opda1 d.122.1.1 (A:1-209) automated matches {Trypanosoma brucei [TaxId: 5702]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedqq
eyleerrlkdlikkhsefigydielmven

Sequence, based on observed residues (ATOM records): (download)

>d3opda1 d.122.1.1 (A:1-209) automated matches {Trypanosoma brucei [TaxId: 5702]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdlkrgtrivlhlkedqqey
leerrlkdlikkhsefigydielmven

SCOPe Domain Coordinates for d3opda1:

Click to download the PDB-style file with coordinates for d3opda1.
(The format of our PDB-style files is described here.)

Timeline for d3opda1: