![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
![]() | Protein automated matches [190459] (50 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [225990] (1 PDB entry) |
![]() | Domain d3op1b1: 3op1 B:2-185 [214455] Other proteins in same PDB: d3op1a2, d3op1b2, d3op1c2 automated match to d1mrza2 complexed with acy, cl, gol, peg, so4 |
PDB Entry: 3op1 (more details), 2.49 Å
SCOPe Domain Sequences for d3op1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3op1b1 c.26.1.0 (B:2-185) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} iitipiknqkdigtpsdsvvvlgyfdgihkghqelfrvankaarkdllpivvmtfnespk ialepyhpdlflhilnpaererklkregveelylldfssqfasltaqeffatyikamnak iivagfdytfgsdkktaedlknyfdgeviivppvedekgkisstrirqaildgnvkeagk llga
Timeline for d3op1b1:
![]() Domains from other chains: (mouse over for more information) d3op1a1, d3op1a2, d3op1c1, d3op1c2 |