SCOPe 2.08: Domain d3op1b1: 3op1 B:2-185

Lineage for d3op1b1 (3op1 B:2-185)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [225990] (1 PDB entry)

8. Domain d3op1b1: 3op1 B:2-185 [214455]
   Other proteins in same PDB: d3op1a2, d3op1b2, d3op1c2
   automated match to d1mrza2
   complexed with acy, cl, gol, peg, so4

Details for d3op1b1

PDB Entry: 3op1, 2.49 Å

PDB Description: Crystal Structure of Macrolide-efflux Protein SP_1110 from Streptococcus pneumoniae

PDB Compounds: (B:) Macrolide-efflux protein

SCOPe Domain Sequences for d3op1b1:

Sequence; same for both SEQRES and ATOM records:

>d3op1b1 c.26.1.0 (B:2-185) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
iitipiknqkdigtpsdsvvvlgyfdgihkghqelfrvankaarkdllpivvmtfnespk
ialepyhpdlflhilnpaererklkregveelylldfssqfasltaqeffatyikamnak
iivagfdytfgsdkktaedlknyfdgeviivppvedekgkisstrirqaildgnvkeagk
llga

Timeline for d3op1b1:

• d3op1b1 first appeared in SCOPe 2.03
  
• d3op1b1 appears in SCOPe 2.07