![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) ![]() |
![]() | Family b.43.5.0: automated matches [227257] (1 protein) not a true family |
![]() | Protein automated matches [227042] (2 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [225991] (1 PDB entry) |
![]() | Domain d3op1a2: 3op1 A:186-305 [214454] Other proteins in same PDB: d3op1a1, d3op1b1, d3op1c1 automated match to d1mrza1 complexed with acy, cl, gol, peg, so4 |
PDB Entry: 3op1 (more details), 2.49 Å
SCOPe Domain Sequences for d3op1a2:
Sequence, based on SEQRES records: (download)
>d3op1a2 b.43.5.0 (A:186-305) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} plpsrgmvvhgnargrtigyptanlvlldrtympadgvyvvdveiqrqkyramasvgknv tfdgeearfevnifdfnqdiygetvmvywldrirdmtkfdsvdqlvdqlkadeevtrnws
>d3op1a2 b.43.5.0 (A:186-305) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} plpsrgmvvhgngyptanlvlldrtympadgvyvvdveiqrqkyramasvgknvtfdear fevnifdfnqdiygetvmvywldrirdmtkfdsvdqlvdqlkadeevtrnws
Timeline for d3op1a2:
![]() Domains from other chains: (mouse over for more information) d3op1b1, d3op1b2, d3op1c1, d3op1c2 |