SCOPe 2.03: Domain d1etzb2: 1etz B:127-228

Lineage for d1etzb2 (1etz B:127-228)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

Species Mouse (Mus musculus) [TaxId:10090] [88576] (414 PDB entries)
Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

Domain d1etzb2: 1etz B:127-228 [21445]
Other proteins in same PDB: d1etza1, d1etza2, d1etzb1, d1etzh1, d1etzl1, d1etzl2
part of anti-sweetener Fab NC10.14
complexed with gas

Details for d1etzb2

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins

PDB Compounds: (B:) fab nc10.14 - heavy chain

SCOPe Domain Sequences for d1etzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzb2 b.1.1.2 (B:127-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp

SCOPe Domain Coordinates for d1etzb2:

Click to download the PDB-style file with coordinates for d1etzb2.
(The format of our PDB-style files is described here.)

Timeline for d1etzb2: