SCOP 1.63: Domain d1etza2: 1etz A:111-215

Lineage for d1etza2 (1etz A:111-215)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-sweetener Fab NC10.14, (mouse), lamba L chain [49108] (1 PDB entry)

8. Domain d1etza2: 1etz A:111-215 [21444]
   Other proteins in same PDB: d1etza1, d1etzb1, d1etzh1, d1etzl1

Details for d1etza2

PDB Entry: 1etz, 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins

SCOP Domain Sequences for d1etza2:

Sequence; same for both SEQRES and ATOM records:

>d1etza2 b.1.1.2 (A:111-215) Immunoglobulin (constant domains of L and H chains) {Anti-sweetener Fab NC10.14, (mouse), lamba L chain}
qpksspsvtlftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsraecs

Timeline for d1etza2:

• d1etza2 first appeared (with stable ids) in SCOP 1.55
  
• d1etza2 appears in SCOP 1.61
  
• d1etza2 appears in SCOP 1.65
  
• d1etza2 appears in the current release, SCOPe 2.08