Lineage for d3olia2 (3oli A:404-496)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804047Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1804076Protein Animal alpha-amylase [51024] (3 species)
  7. 1804077Species Human (Homo sapiens) [TaxId:9606] [51026] (49 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 1804081Domain d3olia2: 3oli A:404-496 [214437]
    Other proteins in same PDB: d3olia1
    automated match to d1jfha1
    complexed with bgc, ca, cl, hsd, mpd, pca, so4

Details for d3olia2

PDB Entry: 3oli (more details), 1.5 Å

PDB Description: structures of human pancreatic alpha-amylase in complex with acarviostatin iv03
PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d3olia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3olia2 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d3olia2:

Click to download the PDB-style file with coordinates for d3olia2.
(The format of our PDB-style files is described here.)

Timeline for d3olia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3olia1