Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Anti-sweetener Fab NC10.14, (mouse), lamba L chain [49108] (1 PDB entry) |
Domain d1etzh2: 1etz H:127-228 [21443] Other proteins in same PDB: d1etza1, d1etzb1, d1etzh1, d1etzl1 |
PDB Entry: 1etz (more details), 2.6 Å
SCOP Domain Sequences for d1etzh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1etzh2 b.1.1.2 (H:127-228) Immunoglobulin (constant domains of L and H chains) {Anti-sweetener Fab NC10.14, (mouse), lamba L chain} akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg lytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp
Timeline for d1etzh2: