Lineage for d1etzl2 (1etz L:111-215)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2361010Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 2361033Domain d1etzl2: 1etz L:111-215 [21442]
    Other proteins in same PDB: d1etza1, d1etzb1, d1etzb2, d1etzh1, d1etzh2, d1etzl1
    part of anti-sweetener Fab NC10.14
    complexed with gas

Details for d1etzl2

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
PDB Compounds: (L:) fab nc10.14 - light chain

SCOPe Domain Sequences for d1etzl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzl2 b.1.1.2 (L:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsraecs

SCOPe Domain Coordinates for d1etzl2:

Click to download the PDB-style file with coordinates for d1etzl2.
(The format of our PDB-style files is described here.)

Timeline for d1etzl2: