Lineage for d3okna2 (3okn A:108-213)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294862Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
  8. 1295023Domain d3okna2: 3okn A:108-213 [214418]
    Other proteins in same PDB: d3okna1
    automated match to d1eapa2
    complexed with zn

Details for d3okna2

PDB Entry: 3okn (more details), 2.15 Å

PDB Description: crystal structure of s25-39 in complex with kdo(2.4)kdo(2.4)kdo
PDB Compounds: (A:) S25-39 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3okna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3okna2 b.1.1.2 (A:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserangvlnswtdqd
skdstysmtstltltkdeyerhnsytceashktstspivksfnrne

SCOPe Domain Coordinates for d3okna2:

Click to download the PDB-style file with coordinates for d3okna2.
(The format of our PDB-style files is described here.)

Timeline for d3okna2: