SCOPe 2.03: Domain d3okma1: 3okm A:1-107

Lineage for d3okma1 (3okm A:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d3okma1: 3okm A:1-107 [214415]
   Other proteins in same PDB: d3okma2
   automated match to d1eapa1

Details for d3okma1

PDB Entry: 3okm, 2.4 Å

PDB Description: crystal structure of unliganded s25-39

PDB Compounds: (A:) S25-39 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3okma1:

Sequence; same for both SEQRES and ATOM records:

>d3okma1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspsslavsagekvtmnckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdfaltissvqaedlavyyckqsynlrtfgggtkleik

Timeline for d3okma1:

• d3okma1 is new in SCOPe 2.03-stable
  
• d3okma1 appears in SCOPe 2.04
  
• d3okma1 appears in the current release, SCOPe 2.08