SCOPe 2.07: Domain d3ojvd1: 3ojv D:147-249

Lineage for d3ojvd1 (3ojv D:147-249)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3ojvd1: 3ojv D:147-249 [214403]
   Other proteins in same PDB: d3ojva_, d3ojvb_
   automated match to d1djsa1

Details for d3ojvd1

PDB Entry: 3ojv, 2.6 Å

PDB Description: crystal structure of fgf1 complexed with the ectodomain of fgfr1c exhibiting an ordered ligand specificity-determining betac'-betae loop

PDB Compounds: (D:) Basic fibroblast growth factor receptor 1

SCOPe Domain Sequences for d3ojvd1:

Sequence; same for both SEQRES and ATOM records:

>d3ojvd1 b.1.1.0 (D:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggy
kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvve

Timeline for d3ojvd1:

• d3ojvd1 first appeared in SCOPe 2.03
  
• d3ojvd1 appears in SCOPe 2.06
  
• d3ojvd1 appears in the current release, SCOPe 2.08