Lineage for d3ojvd1 (3ojv D:147-249)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033576Domain d3ojvd1: 3ojv D:147-249 [214403]
    Other proteins in same PDB: d3ojva_, d3ojvb_
    automated match to d1djsa1

Details for d3ojvd1

PDB Entry: 3ojv (more details), 2.6 Å

PDB Description: crystal structure of fgf1 complexed with the ectodomain of fgfr1c exhibiting an ordered ligand specificity-determining betac'-betae loop
PDB Compounds: (D:) Basic fibroblast growth factor receptor 1

SCOPe Domain Sequences for d3ojvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojvd1 b.1.1.0 (D:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggy
kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvve

SCOPe Domain Coordinates for d3ojvd1:

Click to download the PDB-style file with coordinates for d3ojvd1.
(The format of our PDB-style files is described here.)

Timeline for d3ojvd1: