Lineage for d1c5ch2 (1c5c H:114-230)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292198Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1292202Species Human (Homo sapiens) [TaxId:9606] [88575] (177 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1292203Domain d1c5ch2: 1c5c H:114-230 [21439]
    Other proteins in same PDB: d1c5ch1, d1c5cl1, d1c5cl2
    part of humanized catalytic Fab 21D8 with a decarboxylase activity
    complexed with gol, tk4

Details for d1c5ch2

PDB Entry: 1c5c (more details), 1.61 Å

PDB Description: decarboxylase catalytic antibody 21d8-hapten complex
PDB Compounds: (H:) chimeric decarboxylase antibody 21d8

SCOPe Domain Sequences for d1c5ch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d1c5ch2:

Click to download the PDB-style file with coordinates for d1c5ch2.
(The format of our PDB-style files is described here.)

Timeline for d1c5ch2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5ch1