Lineage for d1c5ch2 (1c5c H:114-230)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103873Species Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains) [49107] (2 PDB entries)
  8. 103874Domain d1c5ch2: 1c5c H:114-230 [21439]
    Other proteins in same PDB: d1c5ch1, d1c5cl1

Details for d1c5ch2

PDB Entry: 1c5c (more details), 1.61 Å

PDB Description: decarboxylase catalytic antibody 21d8-hapten complex

SCOP Domain Sequences for d1c5ch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin (constant domains of L and H chains) {Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1c5ch2:

Click to download the PDB-style file with coordinates for d1c5ch2.
(The format of our PDB-style files is described here.)

Timeline for d1c5ch2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5ch1