SCOPe 2.04: Domain d3ojmb2: 3ojm B:251-361

Lineage for d3ojmb2 (3ojm B:251-361)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3ojmb2: 3ojm B:251-361 [214380]
   Other proteins in same PDB: d3ojma_, d3ojmb1
   automated match to d1ev2g2
   complexed with so4; mutant

Details for d3ojmb2

PDB Entry: 3ojm, 2.1 Å

PDB Description: Crystal Structure of FGF1 complexed with the ectodomain of FGFR2b harboring P253R Apert mutation

PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3ojmb2:

Sequence; same for both SEQRES and ATOM records:

>d3ojmb2 b.1.1.0 (B:251-361) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkhsginssnaevlalfnvteadageyickvsnyigqanqsawltvlpkq

Timeline for d3ojmb2:

• d3ojmb2 first appeared in SCOPe 2.03
  
• d3ojmb2 appears in SCOPe 2.05
  
• d3ojmb2 appears in the current release, SCOPe 2.08