Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188070] (23 PDB entries) |
Domain d3ojmb1: 3ojm B:151-250 [214379] Other proteins in same PDB: d3ojma_, d3ojmb2 automated match to d1ev2g1 complexed with so4; mutant |
PDB Entry: 3ojm (more details), 2.1 Å
SCOPe Domain Sequences for d3ojmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ojmb1 b.1.1.4 (B:151-250) automated matches {Human (Homo sapiens) [TaxId: 9606]} krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve
Timeline for d3ojmb1: