SCOPe 2.02: Domain d1fskl2: 1fsk L:119-220

Lineage for d1fskl2 (1fsk L:119-220)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d1fskl2: 1fsk L:119-220 [21437]
   Other proteins in same PDB: d1fska_, d1fskb1, d1fskb2, d1fskc1, d1fskd_, d1fske1, d1fske2, d1fskf1, d1fskg_, d1fskh1, d1fskh2, d1fski1, d1fskj_, d1fskk1, d1fskk2, d1fskl1
   part of anti-bet v1 Fab BV16

Details for d1fskl2

PDB Entry: 1fsk, 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

PDB Compounds: (L:) antibody heavy chain fab

SCOPe Domain Sequences for d1fskl2:

Sequence; same for both SEQRES and ATOM records:

>d1fskl2 b.1.1.2 (L:119-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1fskl2:

• d1fskl2 first appeared (with stable ids) in SCOP 1.55
  
• d1fskl2 appears in SCOPe 2.01
  
• d1fskl2 appears in SCOPe 2.03
  
• d1fskl2 appears in the current release, SCOPe 2.08