Lineage for d1fski2 (1fsk I:119-220)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655723Domain d1fski2: 1fsk I:119-220 [21435]
    Other proteins in same PDB: d1fska_, d1fskb1, d1fskb2, d1fskc1, d1fskd_, d1fske1, d1fske2, d1fskf1, d1fskg_, d1fskh1, d1fskh2, d1fski1, d1fskj_, d1fskk1, d1fskk2, d1fskl1

Details for d1fski2

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
PDB Compounds: (I:) antibody heavy chain fab

SCOP Domain Sequences for d1fski2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fski2 b.1.1.2 (I:119-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1fski2:

Click to download the PDB-style file with coordinates for d1fski2.
(The format of our PDB-style files is described here.)

Timeline for d1fski2: