SCOP 1.55: Domain d1fski2: 1fsk I:119-220

Lineage for d1fski2 (1fsk I:119-220)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Anti bet v1 Fab BV16, (mouse), kappa L chain [49106] (1 PDB entry)

8. Domain d1fski2: 1fsk I:119-220 [21435]
   Other proteins in same PDB: d1fska_, d1fskb1, d1fskc1, d1fskd_, d1fske1, d1fskf1, d1fskg_, d1fskh1, d1fski1, d1fskj_, d1fskk1, d1fskl1

Details for d1fski2

PDB Entry: 1fsk, 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

SCOP Domain Sequences for d1fski2:

Sequence; same for both SEQRES and ATOM records:

>d1fski2 b.1.1.2 (I:119-220) Immunoglobulin (constant domains of L and H chains) {Anti bet v1 Fab BV16, (mouse), kappa L chain}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1fski2:

• d1fski2 appears in SCOP 1.57
  
• d1fski2 appears in the current release, SCOPe 2.08