SCOPe 2.08: Domain d3oj6b1: 3oj6 B:3-136

Lineage for d3oj6b1 (3oj6 B:3-136)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (16 species)
   not a true protein

7. Species Fungus (Coccidioides immitis) [TaxId:5501] [225967] (1 PDB entry)

8. Domain d3oj6b1: 3oj6 B:3-136 [214347]
   Other proteins in same PDB: d3oj6b2
   automated match to d2z3ia_
   complexed with cl, edo, zn

Details for d3oj6b1

PDB Entry: 3oj6, 1.7 Å

PDB Description: crystal structure of blasticidin s deaminase from coccidioides immitis

PDB Compounds: (B:) Blasticidin-S deaminase

SCOPe Domain Sequences for d3oj6b1:

Sequence, based on SEQRES records:

>d3oj6b1 c.97.1.0 (B:3-136) automated matches {Fungus (Coccidioides immitis) [TaxId: 5501]}
peplsaagqnlidtatsvingipvsdfysvasaaisddgrvfsgvnvyhfnggpcaelvv
lgvaaaagatklthivaianegrgilspcgrcrqvladlhpgikaivigkegpkmvavee
llpsiyawdkdydr

Sequence, based on observed residues (ATOM records):

>d3oj6b1 c.97.1.0 (B:3-136) automated matches {Fungus (Coccidioides immitis) [TaxId: 5501]}
peplsaagqnlidtatsvingipvsdfysvasaaisddgrvfsgvnvyhfnggpcaelvv
lgvaaaagatklthivaianegrgilspcgrcrqvladlhpgikaivigkegpkmvavee
llpsiyawddydr

Timeline for d3oj6b1:

• d3oj6b1 first appeared in SCOPe 2.03, called d3oj6b_
  
• d3oj6b1 appears in SCOPe 2.07