Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
Domain d1fskh2: 1fsk H:108-214 [21434] Other proteins in same PDB: d1fska_, d1fskb1, d1fskc1, d1fskc2, d1fskd_, d1fske1, d1fskf1, d1fskf2, d1fskg_, d1fskh1, d1fski1, d1fski2, d1fskj_, d1fskk1, d1fskl1, d1fskl2 |
PDB Entry: 1fsk (more details), 2.9 Å
SCOP Domain Sequences for d1fskh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fskh2 b.1.1.2 (H:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1fskh2: